Streptomyces violaceoruber: B1H20_09515 Help Entry B1H20_09515       CDS       T05124                                  Name (GenBank) hypothetical protein   KO K05553   minimal PKS acyl carrier protein Organism svu  Streptomyces violaceoruber Pathway svu01056   Biosynthesis of type II polyketide backbone svu01100   Metabolic pathways svu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:svu00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     B1H20_09515    00253 Tetracycline biosynthesis     B1H20_09515  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:svu01004]     B1H20_09515    01008 Polyketide biosynthesis proteins [BR:svu01008]     B1H20_09515 Lipid biosynthesis proteins [BR:svu01004]  Polyketide synthase   Component type    B1H20_09515 Polyketide biosynthesis proteins [BR:svu01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      B1H20_09515     Nonaketide PKS      B1H20_09515     Decaketide PKS      B1H20_09515 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  ARF61613 UniProt:  A0A1V0U8Q2 LinkDB All DBs Position 2173604..2173864 Genome browser AA seq 86 aa AA seqDB search MQQLDLPTLIGLLRTSGGSDTHDLNGDVLDVAFADLGYDSLCLLQVTGVIERDAGVALDE QVLEEAETPRQYIAAVNRVLSPQATA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgcagcagctcgaccttcccaccctgatcggcctcctgcggaccagcgggggcagcgac acccacgacctgaacggggacgtgctggacgtcgcgttcgccgacctcggctacgactcc ctgtgcctcctccaggtcaccggcgtcatcgagcgcgatgcgggggtcgcgctcgacgag caggtgctggaggaggcggagaccccgaggcagtacatcgcggccgtcaaccgggtgctg tctccgcaggccaccgcctga

DBGET integrated database retrieval system