Staphylococcus warneri: A284_07455 Help Entry A284_07455        CDS       T02449                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism swa  Staphylococcus warneri Pathway swa01100   Metabolic pathways swa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:swa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A284_07455 (acpP)    00074 Mycolic acid biosynthesis     A284_07455 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A284_07455 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 Ribosomal_L12_N HLH Motif Other DBs NCBI-ProteinID:  AGC90808 LinkDB All DBs Position complement(1605773..1606006) Genome browser AA seq 77 aa AA seqDB search MENFDKVKDIIVDRLGVDADKVTEDASFKDDLGADSLDIAELVMELEDEFGTEIPDEEAE KINTVGDAVKYINSLEK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggaaaacttcgataaagtaaaggatatcatcgttgaccgtttaggtgttgatgctgat aaagtaactgaagatgcatctttcaaagatgatttaggcgctgactcacttgatatcgct gaattagtaatggaattagaagatgaatttggtactgaaattccagatgaagaagctgaa aaaatcaacactgttggtgatgctgttaagtatatcaatagtcttgaaaaataa

DBGET integrated database retrieval system