Shewanella woodyi: Swoo_2043 Help Entry Swoo_2043         CDS       T00676                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism swd  Shewanella woodyi Pathway swd01100   Metabolic pathways swd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:swd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Swoo_2043    00074 Mycolic acid biosynthesis     Swoo_2043   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Swoo_2043 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB EutQ DUF1896 Motif Other DBs NCBI-ProteinID:  ACA86327 UniProt:  B1KRC0 LinkDB All DBs Position 2509980..2510213 Genome browser AA seq 77 aa AA seqDB search MSNIEERVKKIIIEQLGVKEEDVKSAASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAVDYVSKNQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaacatcgaagaacgtgtaaagaaaatcattattgagcaactaggtgttaaagaa gaagacgttaagtctgcagcatctttcgttgacgacttgggtgcagattctctggacacg gttgagttggttatggctctagaagaagagtttgataccgagatccctgatgaagaagct gaaaagatcactactgttcaagcagcggttgattacgtttcaaagaatcagtaa

DBGET integrated database retrieval system