Shewanella woodyi: Swoo_4596 Help Entry Swoo_4596         CDS       T00676                                  Name (GenBank) conserved hypothetical protein   KO K02078   acyl carrier protein Organism swd  Shewanella woodyi Pathway swd01100   Metabolic pathways swd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:swd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Swoo_4596    00074 Mycolic acid biosynthesis     Swoo_4596   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Swoo_4596 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ACA88846 UniProt:  B1KLW6 LinkDB All DBs Position 5569620..5569877 Genome browser AA seq 85 aa AA seqDB search MMNLHNDIKQLIIDCLDLEDVTVDDIETEAPLFGEGLGLDSIDALELGLAIKKEFDVKIE ANSEATKAHFYSVASLASFIESQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgatgaacttacataacgatataaaacaactaatcatcgattgcttagatctagaagat gtcaccgttgatgatattgaaacagaagcgcccctatttggtgaaggcttaggtttagat tcaatcgatgctctcgagcttggcttagcgattaaaaaagagttcgatgtcaaaatcgaa gcgaactcggaagccacaaaagcacacttctatagcgttgccagcttggctagctttatt gagtcccagcgagcttag

DBGET integrated database retrieval system