Formicincola oecophyllae: E3E12_05035 Help Entry E3E12_05035       CDS       T06093                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism swf  Formicincola oecophyllae Pathway swf02024   Quorum sensing swf03018   RNA degradation Brite KEGG Orthology (KO) [BR:swf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     E3E12_05035 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     E3E12_05035 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:swf03019]     E3E12_05035 (hfq)    03036 Chromosome and associated proteins [BR:swf03036]     E3E12_05035 (hfq) Messenger RNA biogenesis [BR:swf03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      E3E12_05035 (hfq) Chromosome and associated proteins [BR:swf03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     E3E12_05035 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  QDH13658 UniProt:  A0A4Y6UAQ6 LinkDB All DBs Position 1144151..1144435 Genome browser AA seq 94 aa AA seqDB search MTDTTPSNAPSPHAVQDVFLCHLRRSAEAVTIFLVNGVKLQGTVSSFDRNTILLKRDGHV QLVYKSAISTIMPSTPMPRDMVEGLEEYPAAGDF NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgactgacaccaccccctcaaacgctccctccccccatgctgttcaggatgttttcctg tgccacctgcgccgcagcgctgaagctgtgacgattttcctggtcaatggcgtcaagctt caaggcactgtgagtagctttgaccgcaacaccatcctgcttaagcgcgatggtcacgtg cagcttgtctacaaaagcgccatcagcaccatcatgcccagcacacccatgccgcgcgac atggttgaagggcttgaggaataccccgctgcaggtgatttctga

DBGET integrated database retrieval system