Rhizorhabdus wittichii RW1: Swit_0088 Help Entry Swit_0088         CDS       T00538                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism swi  Rhizorhabdus wittichii RW1 Pathway swi01100   Metabolic pathways swi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:swi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Swit_0088    00074 Mycolic acid biosynthesis     Swit_0088   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Swit_0088 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 DUF1493 DUF1409 Motif Other DBs NCBI-ProteinID:  ABQ66460 UniProt:  A0A9J9H7N2 LinkDB All DBs Position 84535..84771 Genome browser AA seq 78 aa AA seqDB search MSETAERVKKIVVEHLGVEAEKVTEEASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKIATVKDAISYIESHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgagaccgccgagcgcgttaagaagatcgttgtcgagcatctgggcgtcgaggcc gagaaggtcaccgaggaagccagcttcatcgacgatctgggcgcggacagcctcgacatc gtcgagctggtcatggctttcgaagaagaattcggcgtcgagattcccgacgacgcggcc gagaagatcgcgaccgtcaaggacgccatcagctatatcgagagccacaagggctga

DBGET integrated database retrieval system