Rhizorhabdus wittichii RW1: Swit_3447 Help Entry Swit_3447         CDS       T00538                                  Name (GenBank) chorismate mutase   KO K04092   chorismate mutase [EC:5.4.99.5] Organism swi  Rhizorhabdus wittichii RW1 Pathway swi00400   Phenylalanine, tyrosine and tryptophan biosynthesis swi01100   Metabolic pathways swi01110   Biosynthesis of secondary metabolites swi01230   Biosynthesis of amino acids Module swi_M00024   Phenylalanine biosynthesis, chorismate => phenylpyruvate => phenylalanine swi_M00040   Tyrosine biosynthesis, chorismate => arogenate => tyrosine Brite KEGG Orthology (KO) [BR:swi00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     Swit_3447 Enzymes [BR:swi01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      Swit_3447 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Motif Other DBs NCBI-ProteinID:  ABQ69793 UniProt:  A0A9J9HDK0 LinkDB All DBs Position complement(3783613..3783897) Genome browser AA seq 94 aa AA seqDB search MADEILSRYRESIDNIDAALIFMLAERFKITQAVGEHKAATGLPPADPGREQIQIDRLRS LAKSANLDPDFSEKFLRFVIDEVIHHHRRAGADG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggccgatgagatcctgagccgctaccgcgagagcatcgacaatatcgatgccgcgctg atcttcatgctggcggagcgcttcaagatcacccaggcggtgggcgagcacaaggccgcc accggcctgccccccgccgatccgggccgcgagcagatccagatcgaccgcctccgctcg ctggcgaagagcgcgaatctcgatcccgacttctcggagaaattccttcgcttcgttatt gacgaagtcatccaccatcatcgccgtgccggcgctgatggttga

DBGET integrated database retrieval system