Rhizorhabdus wittichii RW1: Swit_3818 Help Entry Swit_3818         CDS       T00538                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism swi  Rhizorhabdus wittichii RW1 Pathway swi00362   Benzoate degradation swi00621   Dioxin degradation swi00622   Xylene degradation swi01100   Metabolic pathways swi01120   Microbial metabolism in diverse environments swi01220   Degradation of aromatic compounds Module swi_M00569   Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA Brite KEGG Orthology (KO) [BR:swi00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     Swit_3818    00622 Xylene degradation     Swit_3818    00621 Dioxin degradation     Swit_3818 Enzymes [BR:swi01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      Swit_3818 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Tautomerase_3 Motif Other DBs NCBI-ProteinID:  ABQ70163 UniProt:  A0A9J9HEH8 LinkDB All DBs Position complement(4190995..4191225) Genome browser AA seq 76 aa AA seqDB search MPFVDIRIAGTATRAQKSAIVADVTKALGAHLGKPASAVQVNIIEVSTENYGAGGILIAD RPASPAQEVASADGKR NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgccgttcgtcgacatccgcatcgccggcaccgccacccgtgcgcaaaagtccgccatc gtcgccgacgtgacgaaggccctcggcgcgcatctcggcaagccggcgagcgcggtgcag gtgaacatcatcgaagtctcgaccgagaattacggagccggcggcatcctgatcgccgac cgcccggcaagtcctgcgcaggaggtcgcttctgcggatggcaaacgatga

DBGET integrated database retrieval system