Rhizorhabdus wittichii RW1: Swit_3899 Help Entry Swit_3899         CDS       T00538                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism swi  Rhizorhabdus wittichii RW1 Pathway swi01100   Metabolic pathways swi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:swi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Swit_3899    00074 Mycolic acid biosynthesis     Swit_3899   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Swit_3899 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ABQ70244 UniProt:  A0A9J9HEQ3 LinkDB All DBs Position 4283799..4284041 Genome browser AA seq 80 aa AA seqDB search MSSREDIFTRVAEQIEPFNKKGIDLAETTSFAGDLEWDSLTVMDFVAAVEDEFDIIITMN MQAEIETVGQLVDAVAKLRG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagcagcagagaagacatcttcacccgcgtcgccgagcagatcgagccgttcaacaag aagggcatcgacctggctgagacgacgagcttcgccggcgacctcgaatgggacagcctg acggtcatggatttcgtcgcggcggtggaggatgagttcgacatcatcatcacgatgaac atgcaggccgagatcgagaccgtcggccagctcgtcgatgccgtcgccaagctgcggggc tga

DBGET integrated database retrieval system