Rhizorhabdus wittichii RW1: Swit_4028 Help Entry Swit_4028         CDS       T00538                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism swi  Rhizorhabdus wittichii RW1 Pathway swi01100   Metabolic pathways swi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:swi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Swit_4028   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Swit_4028 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ABQ70372 UniProt:  A0A9J9HF40 LinkDB All DBs Position complement(4430883..4431158) Genome browser AA seq 91 aa AA seqDB search MGAADFDQTEDVVRAVLVEVLALDADRAAGFTADTGLFGSLPELDSMAVAGLLTALEDRL DIIIDDDEVDGEMLESFGALVAFVERKLAAK NT seq 276 nt NT seq  +upstreamnt  +downstreamnt gtgggcgcagccgatttcgaccagacagaggatgtggtgcgcgcggtgctggtcgaggtg ctcgcgctcgacgccgaccgcgccgccggcttcaccgccgacaccggcctgttcgggtcg ctccccgaactcgattcgatggccgtcgccggcctgctgaccgcactcgaggaccggctc gacatcatcatcgacgacgacgaggtcgacggcgagatgctcgaaagcttcggcgcgctg gtggcgttcgtcgagcggaagctggccgcgaaataa

DBGET integrated database retrieval system