Rhizorhabdus wittichii RW1: Swit_5387 Help Entry Swit_5387         CDS       T00538                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism swi  Rhizorhabdus wittichii RW1 Pathway swi01100   Metabolic pathways swi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:swi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Swit_5387    00074 Mycolic acid biosynthesis     Swit_5387   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Swit_5387 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  ABQ71495 UniProt:  A0A9J9LGV9 LinkDB All DBs Position pSWIT01:complement(294041..294277) Genome browser AA seq 78 aa AA seqDB search MTDIATRVANLVAQQLGVDPDKVRPESRFIEDLGADSLDVVELVMAIEEGFDVQIPDDDA EKIVTVRDAVLYIEAAMV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgactgatattgctacgcgcgttgcaaacctggttgcccagcaattgggtgtcgacccc gacaaggtgaggccggaatcccgcttcatagaggatctgggtgcggacagtctggatgtc gtcgaactcgtaatggcgatcgaggaaggcttcgacgtccagataccggacgatgatgcc gagaagatcgtgacggtaagggatgccgttctctatatcgaagccgcgatggtctaa

DBGET integrated database retrieval system