Syntrophomonas wolfei: Swol_0190 Help Entry Swol_0190         CDS       T00396                                  Name (GenBank) anti-sigma-28 factor, FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism swo  Syntrophomonas wolfei Pathway swo02020   Two-component system swo02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:swo00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Swol_0190  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     Swol_0190  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:swo02035]     Swol_0190 Bacterial motility proteins [BR:swo02035]  Flagellar system   Flagellar assembly proteins    Others     Swol_0190 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Peptidase_M17_N_1 Motif Other DBs NCBI-ProteinID:  ABI67542 UniProt:  Q0B0G2 LinkDB All DBs Position 233196..233489 Genome browser AA seq 97 aa AA seqDB search MIISKTQLLNVLKIYNKGDNKVEKAQAARGAARADELAISRESKVKQKAMHAVRQADDIR LEKVAELQEQISAGTYTLSDDEVAEKMIERVLVDRLI NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgattatttccaaaacccaattgctaaatgttttgaagatttacaacaaaggcgataac aaggtggaaaaggcacaggctgccagaggggccgcccgggcggacgaactggctatttcc cgggagagcaaggttaagcagaaggcaatgcatgctgtccggcaggcggatgatattcgc ttggaaaaagtagctgaattgcaggagcagatttccgcaggaacctatacgctatccgat gatgaagtggcggagaagatgatagaaagggttttggtggacaggttaatttag

DBGET integrated database retrieval system