KEGG   Syntrophomonas wolfei: Swol_0699
Entry
Swol_0699         CDS       T00396                                 
Name
(GenBank) Phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
swo  Syntrophomonas wolfei
Pathway
swo00770  Pantothenate and CoA biosynthesis
swo01100  Metabolic pathways
swo01240  Biosynthesis of cofactors
Module
swo_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:swo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Swol_0699
Enzymes [BR:swo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     Swol_0699
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: ABI68023
UniProt: Q0AZ31
LinkDB
Position
799329..799814
AA seq 161 aa
MKLAVYPGSFDPVTNGHIDILEKSSKIFDEIIVAVIHNVTKKALFSLDERVKLIEESTRH
LNNVRVDAFSGLLANYLADKQACAIIRGLRTVTDFEYEMHMAMMNKKLIPNIDTMFFMSD
SQYTFISSSAVKEAALLGGDVGSLVPAVVKAGLEEKMLNDG
NT seq 486 nt   +upstreamnt  +downstreamnt
gtgaaactggctgtttatccggggagctttgacccggtaaccaatgggcacattgatatt
ttggagaaatcgagcaaaatatttgatgaaattatcgtagcggtaatacataatgtcacc
aaaaaggcccttttctccctggatgaacgggtaaagcttattgaggaaagcacccggcac
ctgaacaatgtccgggtagatgctttcagcggactcttggccaattacctggcggacaag
caagcctgtgctattatacgaggcctgcgaacggtgactgactttgaatacgagatgcat
atggccatgatgaacaaaaaactgataccaaatattgataccatgttctttatgtccgac
agccagtacacctttatcagctccagtgcggtaaaagaagccgccctgctgggaggggat
gtaggctcactggtccctgctgtggttaaagccgggttggaagagaagatgctgaacgat
ggttga

DBGET integrated database retrieval system