Syntrophomonas wolfei: Swol_0772 Help Entry Swol_0772         CDS       T00396                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism swo  Syntrophomonas wolfei Pathway swo01100   Metabolic pathways swo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:swo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Swol_0772    00074 Mycolic acid biosynthesis     Swol_0772   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Swol_0772 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 CorC_HlyC ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  ABI68093 UniProt:  Q0AYW1 LinkDB All DBs Position 876943..877194 Genome browser AA seq 83 aa AA seqDB search MQEFFEKARRILAEQLDIDVDLIKMDTTFDEIEADSIDIVEMIMALEDIYDVEFPEEEQK DYETIGSLINDLYEFLKQSKNAK NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtgcaggagttttttgagaaagccaggagaatactggcggaacaactggatattgatgtg gatttgattaaaatggataccacctttgacgaaatcgaagccgattctatcgacattgta gaaatgataatggccctggaagatatctatgatgtcgagtttccggaagaagagcaaaag gattatgaaaccattggcagccttatcaatgacctgtacgaattcctgaaacagagtaaa aatgcaaaatga

DBGET integrated database retrieval system