Sutterella wadsworthensis: I6J16_06165 Help Entry I6J16_06165       CDS       T07195                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sws  Sutterella wadsworthensis Pathway sws01100   Metabolic pathways sws01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sws00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I6J16_06165    00074 Mycolic acid biosynthesis     I6J16_06165   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I6J16_06165 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QQS88767 LinkDB All DBs Position 1595671..1595949 Genome browser AA seq 92 aa AA seqDB search MTTFTPQEEKVYAALSKILTNEFDIPAEKIRPEARLYEDFDIDSIDAVDMIVQLKPYLGN RTVKPEAFKAVRTLGDVVSVIAKIMEEPDPAA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgacgacttttacgcctcaagaagagaaggtctacgccgctctttccaaaatccttacc aacgaattcgatattccggccgagaagatccgacctgaagctcgtctttacgaggacttt gacatcgactccattgatgctgtcgacatgattgtgcagctcaagccctatttgggaaac cgcacagtgaagccggaagctttcaaggctgtacgcactctgggtgatgtcgtttccgtg attgccaaaatcatggaagaacccgatcctgccgcctga

DBGET integrated database retrieval system