Sphingomonas xanthus: FMM02_01670
Help
Entry
FMM02_01670 CDS
T07168
Name
(GenBank) response regulator
KO
K03413
two-component system, chemotaxis family, chemotaxis protein CheY
Organism
sxa
Sphingomonas xanthus
Pathway
sxa02020
Two-component system
sxa02030
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:
sxa00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
FMM02_01670
09140 Cellular Processes
09142 Cell motility
02030 Bacterial chemotaxis
FMM02_01670
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
sxa02022
]
FMM02_01670
02035 Bacterial motility proteins [BR:
sxa02035
]
FMM02_01670
Two-component system [BR:
sxa02022
]
CheA family
CheA-CheYBV (chemotaxis)
FMM02_01670
Bacterial motility proteins [BR:
sxa02035
]
Flagellar system
Chemotaxis proteins
Two component system proteins
FMM02_01670
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
Receiver_CRE1
Motif
Other DBs
NCBI-ProteinID:
QDP18779
UniProt:
A0A516IPH9
LinkDB
All DBs
Position
complement(349068..349433)
Genome browser
AA seq
121 aa
AA seq
DB search
MKTCLIVDDSKVIRKVARHILETLEFQVDEAGDGREALDRCEAKMPDVVLLDWNMPVMSG
MEFLKLLRQRGHADQPKVVFCTTENDMAHIRAALEAGADEYVMKPFDRETLHIKLQLVGV
A
NT seq
366 nt
NT seq
+upstream
nt +downstream
nt
atgaaaacctgcctcatcgtcgacgacagcaaagtgatccgcaaggttgcgcgccatatc
ctcgagaccctggagttccaggtcgacgaggccggcgacgggcgcgaagcgctcgaccgc
tgcgaggccaagatgccggacgtcgtcctgctcgactggaacatgccggtgatgagcggg
atggagttcctcaagctgcttcgccagcggggccacgccgaccagcccaaggtggtgttc
tgcacgaccgagaacgacatggcccatatccgcgccgcgttggaagccggtgctgacgaa
tatgtgatgaagcccttcgatcgcgaaacgctccatatcaagctccagctcgtcggcgta
gcctga
DBGET
integrated database retrieval system