Sphingomonas xanthus: FMM02_01885 Help Entry FMM02_01885       CDS       T07168                                  Name (GenBank) ATP synthase F1 subunit epsilon   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism sxa  Sphingomonas xanthus Pathway sxa00190   Oxidative phosphorylation sxa01100   Metabolic pathways Module sxa_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sxa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     FMM02_01885  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sxa00194]     FMM02_01885 Photosynthesis proteins [BR:sxa00194]  Photosystem and electron transport system   F-type ATPase [OT]    FMM02_01885 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  QDP18816 UniProt:  A0A516IPP0 LinkDB All DBs Position 391787..392047 Genome browser AA seq 86 aa AA seqDB search MADLHFELVTPEKLVRSDEVHMVVVPGVEGEFGVMAGHAPFMTTLKDGELKVYKTAGAAP ESIAVSGGFAEVGGKGLTVLAESAAA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggccgaccttcatttcgaactggtgactccggaaaagctcgtccgttcggacgaggta cacatggttgtcgtccccggcgtcgaaggcgaattcggtgtcatggccggccatgcgccc ttcatgaccacgctgaaagacggcgaattgaaagtctacaagaccgccggcgcggcgccc gagagcatcgccgtcagcgggggcttcgccgaagtcggcggcaagggcctcaccgtgctt gctgaaagcgccgcggcctag

DBGET integrated database retrieval system