Sphingomonas xanthus: FMM02_02475 Help Entry FMM02_02475       CDS       T07168                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism sxa  Sphingomonas xanthus Pathway sxa00190   Oxidative phosphorylation sxa01100   Metabolic pathways Module sxa_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sxa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     FMM02_02475  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sxa00194]     FMM02_02475 Photosynthesis proteins [BR:sxa00194]  Photosystem and electron transport system   F-type ATPase [OT]    FMM02_02475 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C DUF5671 SP_C-Propep Motif Other DBs NCBI-ProteinID:  QDP18925 UniProt:  A0A516IPT3 LinkDB All DBs Position complement(501886..502113) Genome browser AA seq 75 aa AA seqDB search MDATAAKLLGAGLAAIGVGMAAIGVGNVFGSFLESALRNPAAADGQQGRLFIGFAAAELL GLLAFVVAMILLFVA NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggacgcgactgctgcgaagcttctgggtgccggtctcgccgcgatcggcgttggcatg gccgcgatcggcgtgggcaacgttttcggctcgttcctcgaaagcgcgctgcgtaacccg gccgccgccgacggccagcagggccgcctgttcatcggcttcgccgctgccgaacttctc ggcctgctggcgttcgtcgttgcgatgattctgctgttcgtcgcctaa

DBGET integrated database retrieval system