KEGG   Sphingomonas xanthus: FMM02_04340
Entry
FMM02_04340       CDS       T07168                                 
Symbol
smc
Name
(GenBank) chromosome segregation protein SMC
  KO
K03529  chromosome segregation protein
Organism
sxa  Sphingomonas xanthus
Brite
KEGG Orthology (KO) [BR:sxa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sxa03036]
    FMM02_04340 (smc)
Chromosome and associated proteins [BR:sxa03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    FMM02_04340 (smc)
SSDB
Motif
Pfam: SMC_N AAA_23 AAA_21 AAA_15 ABC_tran AAA_29
Other DBs
NCBI-ProteinID: QDP19259
UniProt: A0A516IQV4
LinkDB
Position
complement(860904..864326)
AA seq 1140 aa
MRFRRLKLSGFKSFVEPAELRIEPGLTGVVGPNGCGKSNLLEAIRWVMGEGSPKSLRGGG
MEDVIFAGTATRPPRDFAEVSLLIEHEAGEGGSDLATESEVTRRIERGAGSAYRLDGRDV
RQKDVSLLFADAATGAHSPALVSQGRIGAVIAAKPVERRMMLEEAAGISGLHARRKDAEA
KLRATEANLQRLDELLSDQEARASALRRQARAAERYRALSDKIRLAEGRLVYARWHEADR
AAVAALEEARACEREVHRLGEAMQAAQSLQEQAAAALAERREAAIAARDTGRTLAHELAT
ARARRDTVVRRLAELVRLAEALSAETAREVALKADAARAIEALDQERKTIEERLADAETV
AARIATELTAAEAASREAEAALAGLLAREAAMRAERRVADAALEAARSQWGRVEAEAERL
ASQLGNVGDGAIERAAIAQASRQSKQSEQELVRAEAALDEAEAQRAAAAATRDEAESALA
AARAALSAANAERDALARALDHGGGAALAELRAAPGYELALAAALGEDIEAVLGDKGQRR
WQGSEASASDPPLAPGLTRLLDHVDAPKALHRRLAQVGMAENDEGQPLAVGQRLVTRDGV
LRRWDGFVSEGGGAAAAERLLRANRLAEIDRSLPPLQQVVRDAEGVRDGAAAAVEAHRQQ
AERARADAAMAERTGRDAARAGDSAAAALERLDAQRAGLEERKTDLAPLAEAARRAVDEA
MAALAALPDPDTLGDEVGAARAAAAQAGEAVADCRARSATRARETAADRERHAAAGRESG
EWRTRALQAERRLAETASRAMAMEEEQEELADQPDRHAIEIERLEQQGATSEARIAETLE
AERNAQEAVTIAGRALAEAGEAFAAAREARAGAAARAEAQAGRRQEYARICGEKFQCPPP
LLPERLGFAADDFADPEAEKDSLDRLTADRERIGPVNLVAEQELAELDTSREANIAEKDE
LAQAVLRLRGSIGSLNREGRIRLVDAFEKVNSHFGSLFTTLFDGGQAHLELVESDDPLEA
GLEIMAQPPGKRLSTLTLLSGGEQALTAVALIFALFLTNPAPICVLDEVDAPLDDANVDR
FCDLLDRMTGETDTRYLIVTHNAVTMSRMHRLYGVTMIERGVSRLVSVDLGGAEELLAAE
NT seq 3423 nt   +upstreamnt  +downstreamnt
ttgcgcttccgccgactgaaactcagcggcttcaaaagcttcgtcgaacccgccgagtta
aggatcgagccggggctgacgggagtcgtcggccccaatggttgcggcaaatccaacctg
ctcgaagcgatccgctgggtgatgggcgaaggctcgcccaagtcgttgcgcggcggcggg
atggaagacgtcatcttcgccggaaccgccacccgtccacctcgcgacttcgccgaagtc
tcgctgctgatcgagcacgaagcgggcgagggcggttcagacctcgcgaccgaaagcgag
gtcacccgccggatcgagcgcggcgcgggctccgcctaccggctagacggacgcgacgtg
cggcagaaggatgtgtcgctgctgttcgccgacgcggcgaccggcgctcattcgcccgcg
ctggtcagccaaggccgcattggcgcagtgattgccgccaagcccgtggaacggcggatg
atgctggaggaggcggccggcatttcgggcctccatgcgcggcgcaaggacgccgaggcc
aagcttcgcgcgacggaggcgaacctccagcggctcgatgaactgctgagcgaccaggaa
gcgcgcgcgtccgcgctgcgcaggcaggcgcgcgccgccgaacgctatcgcgcgctgagc
gacaaaatccggctggccgagggccgactggtctacgctcgctggcatgaagccgaccga
gcagcagtcgcggctttggaagaagccagggcatgcgagcgcgaagtccatcggctgggc
gaagcgatgcaggcggcccagtcgctccaggaacaggcggcggcggcgcttgcggagcgg
cgcgaggccgcgatcgcggcgcgcgacaccggacgaacgctggcgcatgagttggcgacg
gcacgggccaggcgcgacacggtggtgcgccggctcgcggaactggtccggctggccgag
gcgctttcggcggaaaccgcgcgcgaggtagctctcaaggccgatgcggcgcgggcgatc
gaagcgctcgaccaggaacgcaagacgatcgaggaaaggctggccgacgcggaaacggtc
gcggcccgaatcgccactgaactgaccgcggccgaagcggcctcgcgcgaggctgaagcg
gcgctggccggattgctggcccgcgaggccgctatgcgcgcggagcggcgagttgccgac
gcagcgctggaggcggcacgatcgcagtggggccgggtcgaggcggaagccgaacgactt
gcaagccagcttggcaatgtcggtgacggcgcgatcgaacgtgcggcaatcgcgcaggcg
tcacggcaatcgaagcagtccgagcaggaattggtcagggccgaagcggcgctggacgag
gcggaggcccagcgcgctgcggccgccgcgacccgtgacgaggcagagagcgcacttgcg
gctgcccgggcggcgctgagcgcggcaaatgcggagcgcgacgcgctggcccgtgcgctc
gatcatggcggcggcgcggcattggccgaactacgagccgcgccaggctatgagctggcc
ctggcggcggcgcttggcgaggatatcgaggcggtgctcggcgacaagggccaacgccgt
tggcaaggaagcgaagcctcggcatcggatccgccgctggcgccgggacttacccggctg
ctcgatcatgtcgacgcgcccaaagcgctgcatcggcggctcgcgcaggtcggcatggcc
gaaaacgacgaagggcagccccttgccgttggtcagcgcctcgtgactcgcgacggcgtc
ctgcgccgctgggacggattcgtcagcgaaggcggcggcgcagcggcggctgagcggttg
ctgcgcgccaaccggctggcggagatcgaccgaagcttgccgccattgcagcaggtggtc
cgtgacgccgagggtgttcgcgacggggcggcggcggctgtcgaagcccatcgccagcag
gccgagcgggcacgggccgatgctgcaatggcggaacgaacgggccgtgacgccgcgcgg
gcgggggatagcgccgcggcagccctggagcggctcgacgcccagcgcgccggactggaa
gagcgcaagaccgaccttgcaccgcttgccgaggccgcgcggcgcgcggtcgacgaggcg
atggcggcgcttgccgcgctgcccgacccggatacgctgggcgacgaggtcggcgccgcg
cgcgcggctgctgcccaggctggtgaagcggtggcggactgtcgggcccgttccgccacc
cgcgcccgcgagaccgccgctgaccgcgagcgccatgccgccgcggggcgggaatcggga
gaatggcgtacccgcgcgttgcaggccgagcggcgactggcggaaaccgcgtcgcgtgcg
atggcgatggaggaggagcaggaggagctcgccgaccagcccgaccgccatgctatcgaa
atcgaacgccttgaacagcagggcgcgaccagcgaggcgcgcattgcagagacattggag
gccgagcggaacgcgcaggaagcggtcacgatcgccgggcgggcgctggcggaggccggc
gaagcctttgcggcggcgcgcgaggcccgtgccggcgccgcggcccgggccgaggcacag
gccgggcggcggcaggaatatgcccgcatctgcggcgaaaaatttcaatgtccgccgccg
cttttgcccgaacgcttgggctttgccgccgacgacttcgctgatccggaggcggagaag
gacagtctcgaccggctgactgccgaccgtgagcggatcggcccggtcaaccttgtcgcc
gagcaggaactggccgaactcgacaccagccgggaggccaatatcgcagaaaaagatgag
cttgcacaagcggtcctgcgccttcgtggatcgatcggcagcctcaatcgcgaaggtcgc
atccggctggtcgacgcgttcgaaaaggtcaattcgcatttcggcagtctgttcaccacc
cttttcgacggcggccaggcccatctcgaactcgttgaaagcgacgatccgctcgaggca
ggactggagatcatggcccagccgcccggcaagcgattgtcgacgctgacccttttgtcg
ggcggcgaacaggcgctgaccgcggttgcgttgatcttcgccctgttcctgaccaatccg
gcgccgatctgcgtgctcgacgaggtcgacgccccgctcgatgatgccaatgtcgaccgt
ttctgtgacttgctcgaccggatgaccggtgaaaccgacacccgctacctcatcgtcact
cataatgcggtaacaatgagccggatgcatcgcctttacggcgtgaccatgatcgagcgc
ggggtcagccggctcgtgtcggtcgaccttggcggggcggaagagctgctggccgcggag
tga

DBGET integrated database retrieval system