Sphingomonas xanthus: FMM02_10445 Help Entry FMM02_10445       CDS       T07168                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sxa  Sphingomonas xanthus Pathway sxa01100   Metabolic pathways sxa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sxa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FMM02_10445    00074 Mycolic acid biosynthesis     FMM02_10445   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FMM02_10445 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF3782 Motif Other DBs NCBI-ProteinID:  QDP20625 UniProt:  A0A516IUP3 LinkDB All DBs Position complement(2072019..2072291) Genome browser AA seq 90 aa AA seqDB search MAWDDRAEVDATLRALLVDVLGISAERAAAFDEETELFGALPEFDSMAVATLLTEMEERL GILIEDEDVEAEDLMSFGRLLALAQRLSLT NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtggcgtgggacgatcgcgcggaagtggatgcgacgctgcgcgcgctactggtcgacgtg ctggggatatccgcggagcgcgccgcggcgttcgatgaagagaccgagctgttcggcgcc ctgcctgaattcgattcgatggcggtcgcaaccctgctcaccgagatggaagagcggctt ggcatcctgatcgaggatgaggatgtcgaggcggaagacctgatgagcttcggccgcctt cttgcgctcgcacagcggctttctctgacctag

DBGET integrated database retrieval system