Streptomyces xiamenensis: SXIM_35680 Help Entry SXIM_35680        CDS       T03904                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism sxi  Streptomyces xiamenensis Pathway sxi00253   Tetracycline biosynthesis sxi01056   Biosynthesis of type II polyketide backbone sxi01100   Metabolic pathways sxi01110   Biosynthesis of secondary metabolites Module sxi_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:sxi00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     SXIM_35680    00253 Tetracycline biosynthesis     SXIM_35680  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:sxi01004]     SXIM_35680    01008 Polyketide biosynthesis proteins [BR:sxi01008]     SXIM_35680 Lipid biosynthesis proteins [BR:sxi01004]  Polyketide synthase   Component type    SXIM_35680 Polyketide biosynthesis proteins [BR:sxi01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      SXIM_35680     Nonaketide PKS      SXIM_35680     Decaketide PKS      SXIM_35680 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PilB3_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AKG44952 UniProt:  A0A0F7FWG8 LinkDB All DBs Position complement(3806871..3807140) Genome browser AA seq 89 aa AA seqDB search MASGEFTVTDLRRILHAAAGESDGADLDLSTLDTDFTQLGYDSLARLETGSRIEREFGIK LDDTTLLEAETPGALIEAVNAQLAVSGTP NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggcatccggggaattcaccgtcaccgacctcagacgcatcctgcacgcggccgccggc gaaagcgacggggccgatctcgatctcagcaccctggacaccgatttcacccagctcggc tatgactcactggcccggctggaaaccggaagccgcatcgagcgggaattcggtatcaag ctggatgacaccacactgctcgaagcggaaaccccgggcgccctgatcgaggccgtgaac gcccaactcgccgtttccgggaccccctga

DBGET integrated database retrieval system