Streptomyces xiamenensis: SXIM_35850 Help Entry SXIM_35850        CDS       T03904                                  Name (GenBank) polyketide cyclase   KO K15926   cyclase Organism sxi  Streptomyces xiamenensis Pathway sxi01057   Biosynthesis of type II polyketide products sxi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sxi00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01057 Biosynthesis of type II polyketide products     SXIM_35850  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sxi01008]     SXIM_35850 Polyketide biosynthesis proteins [BR:sxi01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Nonaketide PKS      SXIM_35850 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cyclase_polyket Motif Other DBs NCBI-ProteinID:  AKG44969 UniProt:  A0A0F7FY49 LinkDB All DBs Position 3822891..3823217 Genome browser AA seq 108 aa AA seqDB search MHSNLIVARMAPESTADVARIFSAFDSTDMPHRMGTRRRQLFSFHGLYFHLQDFDGDNGG TLIEEAKTDPRFIRVSQDLKPYIDAFDPATWRTPADAMAQRFYSWESA NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgcacagcaatctgatcgtggccaggatggccccggagtccaccgccgatgtggcccgg atcttcagcgcgttcgacagcaccgacatgccgcaccggatgggaacccggcggcgtcag ctgttctccttccacggcctgtacttccatctccaggacttcgacggcgacaacggcggg acgctcatcgaagaggccaagaccgacccgcggttcatccgcgtcagccaggacctgaag ccgtacatcgacgccttcgacccggcgacctggcggacgccggccgacgccatggcgcag cgcttctacagctgggagtccgcgtga

DBGET integrated database retrieval system