KEGG   Streptomyces xiamenensis: SXIM_53850
Entry
SXIM_53850        CDS       T03904                                 
Name
(GenBank) abc transporter permease
  KO
K25677  pectin-derived oligosaccharide transport system permease protein
Organism
sxi  Streptomyces xiamenensis
Brite
KEGG Orthology (KO) [BR:sxi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sxi02000]
    SXIM_53850
Transporters [BR:sxi02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Pectin-derived oligosaccharide transporter
    SXIM_53850
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-ProteinID: AKG46769
UniProt: A0A0F7G2F2
LinkDB
Position
5854598..5855545
AA seq 315 aa
MSALGEFRTLSKSRGTRAGDGERRERNRDNKAAALFLAPWVLGLLGITIGPMIASLYLAF
TDYNLLQDPQFTGLDNIRRMLSDERLAQSLQVTFVYVLVAVPLQLMVALALALLLDRGVR
GLPLYRSVLYLPSLLGASVAIAVLWRLVFGAQGLVNAFLALFGIEGPGWVSDPDTALGTL
IILHVWTFGAPMVIFLAGLRQIPRELYEAAATDGASRRRQLFSITLPLLSPIIFFNLVLG
LIGSFQSFTQAFIVSGGTGGPSDSTLFFSLYLYQEGFTSFRMGYASALAWLLLLIIGAFT
AVNFWASKYWVFYND
NT seq 948 nt   +upstreamnt  +downstreamnt
atgagcgcgctgggcgagttccgcacgctcagcaagtcacgcggcacacgggcgggcgac
ggggagcgaagagaacggaaccgcgacaacaaggcggcagcgctcttcctggcgccgtgg
gtgctgggactgctcggtatcaccatcggcccgatgatcgcctcgctgtatctggcgttc
acggactacaacctgctgcaggacccgcagttcaccggcctggacaatatccgccggatg
ctgtccgacgaacgtctcgcgcagtccctgcaggtcacgttcgtctacgtgctggtggcg
gtgccgttgcagctgatggtggcgctcgctctggcgctgctgctggaccgcggtgtccgc
ggtctgccgctctaccgctccgtcctctacctgccctcgctgctgggcgccagtgtcgcc
atcgccgtgctgtggcgactggtgttcggggcccagggcctggtgaacgccttcctggcc
ctgttcggtatcgagggcccgggctgggtgtccgatccggacaccgcgctgggcacactg
atcattctgcacgtgtggacgttcggcgcgccgatggtgatcttcctggcggggctgcgg
cagattccgcgagagctgtacgaggcggcggccaccgatggggcctccaggcggcggcag
ctgttctcgatcacgctgccgctgctgagtccgatcatcttcttcaacctggtgctcggg
ttgatcgggagtttccagtccttcacccaggcgttcatcgtctcgggcgggacaggcggg
cccagtgactcgacgctgttcttctcgctctacctctaccaggaggggttcaccagtttc
cgcatgggttacgcgtcggcgctggcgtggctgcttctgctgatcatcggagcgttcacc
gcggtgaacttctgggcgtccaagtattgggttttctacaatgactga

DBGET integrated database retrieval system