Staphylococcus xylosus SMQ-121: SXYLSMQ121_1575 Help Entry SXYLSMQ121_1575   CDS       T03311                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism sxl  Staphylococcus xylosus SMQ-121 Pathway sxl01100   Metabolic pathways sxl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sxl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SXYLSMQ121_1575    00074 Mycolic acid biosynthesis     SXYLSMQ121_1575   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SXYLSMQ121_1575 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AID43006 UniProt:  A0A418I7Q9 LinkDB All DBs Position complement(1715747..1715980) Genome browser AA seq 77 aa AA seqDB search MENFDKVKDIIVDRLGVDAEKVTKDASFKDDLGADSLDIAELVMELEDEFGTEIPDEEAE KINTVGDAVNFINSIEK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggaaaacttcgacaaagtaaaagatattatagttgaccgtttaggtgttgacgctgaa aaagttactaaagatgcatcttttaaagatgatttaggcgctgactcactagatatcgct gaattagtaatggaattagaagacgaatttggtactgaaattccagatgaagaagctgaa aaaatcaacacagttggtgatgcggttaactttatcaatagtattgaaaaataa

DBGET integrated database retrieval system