Shewanella xiamenensis: MKD32_01920 Help Entry MKD32_01920       CDS       T08228                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sxm  Shewanella xiamenensis Pathway sxm01100   Metabolic pathways sxm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sxm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MKD32_01920    00074 Mycolic acid biosynthesis     MKD32_01920   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MKD32_01920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  UML94122 LinkDB All DBs Position complement(401513..401761) Genome browser AA seq 82 aa AA seqDB search MQNREQILAMLTTILVDEFEIDADAITPDANLYEELDLDSIDAVDLVIKLQQLTGKKIQP DEFKSVRTVNDVVNAIEGLVKD NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcaaaaccgtgaacaaatcctcgctatgctgaccacgattttagtggatgagtttgaa atcgatgccgatgcgattacccctgacgccaatctttacgaagagttagatctggacagt attgatgccgtcgatctggtgattaagctgcaacaactgacaggcaaaaaaattcaaccc gatgaatttaaatccgttcgtaccgtcaatgatgtggtcaacgccattgaaggcctagta aaagactaa

DBGET integrated database retrieval system