Streptomyces xanthii: IAG42_24580 Help Entry IAG42_24580       CDS       T07861                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sxn  Streptomyces xanthii Pathway sxn01100   Metabolic pathways sxn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sxn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IAG42_24580    00074 Mycolic acid biosynthesis     IAG42_24580   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IAG42_24580 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QNS06446 UniProt:  A0A7H1BCJ1 LinkDB All DBs Position complement(5464558..5464806) Genome browser AA seq 82 aa AA seqDB search MAATQEEIVAGLAEIVNEIAGIPTEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DDDVKNLKTVGDATKYILDHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagatcgtcgcgggtctcgccgagatcgtgaacgagatcgcc ggcatccccaccgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaagagcgcttcgacgtcaagatcccg gacgacgacgtcaagaacctcaagaccgtcggcgacgccacgaagtacatcctcgaccac caggcctga

DBGET integrated database retrieval system