Streptomyces xanthii: IAG42_35935 Help Entry IAG42_35935       CDS       T07861                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism sxn  Streptomyces xanthii Pathway sxn00253   Tetracycline biosynthesis sxn01056   Biosynthesis of type II polyketide backbone sxn01100   Metabolic pathways sxn01110   Biosynthesis of secondary metabolites Module sxn_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:sxn00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     IAG42_35935    00253 Tetracycline biosynthesis     IAG42_35935  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:sxn01004]     IAG42_35935    01008 Polyketide biosynthesis proteins [BR:sxn01008]     IAG42_35935 Lipid biosynthesis proteins [BR:sxn01004]  Polyketide synthase   Component type    IAG42_35935 Polyketide biosynthesis proteins [BR:sxn01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      IAG42_35935     Nonaketide PKS      IAG42_35935     Decaketide PKS      IAG42_35935 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QNS09158 UniProt:  A0A7H1BKA3 LinkDB All DBs Position unnamed1:15331..15588 Genome browser AA seq 85 aa AA seqDB search MNIDDLRRILVECAGDDGTGSLDGDILDTPFADLGYDSLALMETASRIKQEFGVVILDED IATVETPRVLLRIVSDLASSPAAAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaacatcgatgatctccgtaggatcctcgtcgagtgcgcgggcgatgacgggaccggg agccttgacggcgacattctcgacacccccttcgccgacctcggctacgactcgctggct ctgatggagacggcgagccgtatcaagcaggagttcggcgtggtcatcctcgacgaggac atcgccacggtggagacgccgcgggtcctgctgaggatcgtctcggacctcgcgagctcg ccggccgcagccgcatga

DBGET integrated database retrieval system