Streptomyces xanthii: IAG42_36725 Help Entry IAG42_36725       CDS       T07861                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism sxn  Streptomyces xanthii Pathway sxn00253   Tetracycline biosynthesis sxn01056   Biosynthesis of type II polyketide backbone sxn01100   Metabolic pathways sxn01110   Biosynthesis of secondary metabolites Module sxn_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:sxn00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     IAG42_36725    00253 Tetracycline biosynthesis     IAG42_36725  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:sxn01004]     IAG42_36725    01008 Polyketide biosynthesis proteins [BR:sxn01008]     IAG42_36725 Lipid biosynthesis proteins [BR:sxn01004]  Polyketide synthase   Component type    IAG42_36725 Polyketide biosynthesis proteins [BR:sxn01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      IAG42_36725     Nonaketide PKS      IAG42_36725     Decaketide PKS      IAG42_36725 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QNS09392 UniProt:  A0A7H1BKY7 LinkDB All DBs Position unnamed1:276065..276313 Genome browser AA seq 82 aa AA seqDB search MADLTTLLRECAGEGEGVDLDGDVMDVLFVDLGYDSLAVLQTTGRIERDYDVVLDEEAVD EAETPRALLEIVNRALSARASA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcggatctgaccaccctgctgcgcgagtgcgccggcgagggcgaaggcgtcgacctc gacggcgacgtcatggacgtcctcttcgtcgacctcggctacgactcgctcgccgtcctg cagaccaccggccggatcgagcgcgactacgacgtcgtgctcgacgaggaggccgtcgac gaggccgagacgccccgcgccctcctggagatcgtcaaccgggccctgtccgcccgcgcc agcgcctga

DBGET integrated database retrieval system