Sphingobium yanoikuyae: A6768_02080 Help Entry A6768_02080       CDS       T05170                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism sya  Sphingobium yanoikuyae Brite KEGG Orthology (KO) [BR:sya00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:sya03110]     A6768_02080 (grxC) Chaperones and folding catalysts [BR:sya03110]  Protein folding catalysts   Protein disulfide isomerase    A6768_02080 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 SH3BGR Glrx-like Motif Other DBs NCBI-ProteinID:  ATI78906 UniProt:  A0A085K3R9 LinkDB All DBs Position 442748..443005 Genome browser AA seq 85 aa AA seqDB search MAKVEIYTKDWCGYCARAKALLEGKGVAFEEYDISLGGPRREEMLERAPGRTTVPQIFID GQHIGGSDDLAALNREGKLDPLLGL NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggcaaaggtcgaaatctataccaaggactggtgcggctattgcgcgcgggccaaggca ctgctggagggcaagggtgttgccttcgaggaatatgacatctcgctgggcggccccagg cgcgaggaaatgctggagcgggcgccgggacgcaccaccgtgccgcagatcttcatcgac ggtcagcatatcggcggcagcgacgaccttgctgcgctgaaccgcgaaggcaagctcgac ccgctgctggggctgtaa

DBGET integrated database retrieval system