Sphingobium yanoikuyae: A6768_14880 Help Entry A6768_14880       CDS       T05170                                  Name (GenBank) chorismate mutase   KO K04092   chorismate mutase [EC:5.4.99.5] Organism sya  Sphingobium yanoikuyae Pathway sya00400   Phenylalanine, tyrosine and tryptophan biosynthesis sya01100   Metabolic pathways sya01110   Biosynthesis of secondary metabolites sya01230   Biosynthesis of amino acids Module sya_M00024   Phenylalanine biosynthesis, chorismate => phenylpyruvate => phenylalanine sya_M00040   Tyrosine biosynthesis, chorismate => arogenate => tyrosine Brite KEGG Orthology (KO) [BR:sya00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     A6768_14880 Enzymes [BR:sya01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      A6768_14880 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Motif Other DBs NCBI-ProteinID:  ATI81140 UniProt:  A0A084ERZ2 LinkDB All DBs Position complement(3230260..3230538) Genome browser AA seq 92 aa AA seqDB search MDETLKRYRESIDNIDAALVFMLAERFKVTQAVGEYKATHDLPPADPGREERQISRLRQL ALDANLDPDFTEKFLRFIIDEVIRHHERLREG NT seq 279 nt NT seq  +upstreamnt  +downstreamnt gtggacgagactttgaagcgctatcgcgagagcatcgacaatatcgacgcggcgctcgtc ttcatgctggcggagcggttcaaggtcacccaggccgtgggcgaatataaggcgacccac gacctgccgccggccgatccgggccgggaggaacgccagatttcgcgcctgcgccagctc gcgctcgacgccaatctcgatcccgacttcaccgagaaattcctgcgcttcatcattgat gaggtgatccgtcatcatgagcggctgcgggaaggctga

DBGET integrated database retrieval system