Sphingobium sp. YBL2: TZ53_09085 Help Entry TZ53_09085        CDS       T03855                                  Name (GenBank) phenol hydroxylase   KO K16245   phenol/toluene 2-monooxygenase (NADH) P4/A4 [EC:1.14.13.244 1.14.13.243] Organism syb  Sphingobium sp. YBL2 Pathway syb00361   Chlorocyclohexane and chlorobenzene degradation syb00362   Benzoate degradation syb00623   Toluene degradation syb01100   Metabolic pathways syb01120   Microbial metabolism in diverse environments syb01220   Degradation of aromatic compounds Module syb_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:syb00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     TZ53_09085    00361 Chlorocyclohexane and chlorobenzene degradation     TZ53_09085    00623 Toluene degradation     TZ53_09085 Enzymes [BR:syb01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      TZ53_09085     1.14.13.244  phenol 2-monooxygenase (NADH)      TZ53_09085 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_monoox Motif Other DBs NCBI-ProteinID:  AJR23856 UniProt:  A0A0C5XGL7 LinkDB All DBs Position 1978763..1979122 Genome browser AA seq 119 aa AA seqDB search MAVKAIDTYEFEPADKAENFHGACVIYAGWDGHLLFSSPYAWPLPPDLPFAHFIAGPMAE IFGQHPDWAGIDWNSAVWTRNGEAFAPDMQASIAANGLSHKDALRFRTPGRDGLNGAGI NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggccgtcaaagccatcgacacctatgaattcgaaccggccgacaaggctgaaaatttc cacggcgcctgcgtcatctatgccggctgggacgggcatctgctcttttccagcccctat gcctggccgttgccgccggacctgcccttcgcgcacttcatcgccggacccatggcggag attttcggccagcatcccgactgggcggggatcgactggaacagcgccgtctggacccgt aacggcgaagccttcgcccccgacatgcaggccagcatcgcggccaatggcctcagccac aaggatgcgttgcgcttccgcacgcctggccgcgacggcctgaacggagccggcatctga

DBGET integrated database retrieval system