Sphingobium sp. YBL2: TZ53_09595 Help Entry TZ53_09595        CDS       T03855                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism syb  Sphingobium sp. YBL2 Pathway syb01100   Metabolic pathways syb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:syb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     TZ53_09595    00074 Mycolic acid biosynthesis     TZ53_09595   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     TZ53_09595 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding EvrA_C ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  AJR23940 LinkDB All DBs Position 2102321..2102551 Genome browser AA seq 76 aa AA seqDB search MAVNMDDLLNLVGDIIEVDPSRIDLRLDRDDVPGWDSLAHLRIITAFEAQYGVRLSMDQI AEIRTVEQLSRTLGEA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggctgtgaacatggacgacctgctgaaccttgtcggcgacatcatcgaagtcgatccg tcccggatcgacctgcgcctcgaccgggacgacgtgcccggctgggattcgctggcccat ctgcggatcatcaccgcgttcgaggcgcaatatggcgtgcgcctcagcatggaccagatc gccgagatccgcacggtggaacaattgtcgcggacattgggcgaggcgtga

DBGET integrated database retrieval system