Sphingobium sp. YBL2: TZ53_15520 Help Entry TZ53_15520        CDS       T03855                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism syb  Sphingobium sp. YBL2 Pathway syb01100   Metabolic pathways syb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:syb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     TZ53_15520    00074 Mycolic acid biosynthesis     TZ53_15520   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     TZ53_15520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AJR24921 UniProt:  A0A0C5XJI3 LinkDB All DBs Position complement(3346707..3346997) Genome browser AA seq 96 aa AA seqDB search MRADNAQPVDRAMDIETMMRALLRDVLALSQDRVDAFDADTPLFGALPELDSMAVAGLLT EMEDRFGILIEDEDIDGDTFETFGSLVAFARAKIGG NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgcgggcggacaatgcacaaccggtcgaccgggcaatggatattgaaacgatgatgcgc gccttgctgcgcgatgtgctggccctgtcgcaggaccgggtagacgccttcgatgcggat acgccgctgttcggcgcgctgccggaactggactccatggccgttgcgggcctgctcacc gagatggaggaccgcttcggcatcctgatcgaggacgaggatatagacggcgatacgttc gagacgttcggctcgctcgtcgcctttgcgcgggcgaagatcgggggctga

DBGET integrated database retrieval system