Sphingobium sp. YBL2: TZ53_15995 Help Entry TZ53_15995        CDS       T03855                                  Name (GenBank) molecular chaperone GroES   KO K04078   chaperonin GroES Organism syb  Sphingobium sp. YBL2 Brite KEGG Orthology (KO) [BR:syb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:syb03110]     TZ53_15995    03029 Mitochondrial biogenesis [BR:syb03029]     TZ53_15995 Chaperones and folding catalysts [BR:syb03110]  Heat shock proteins   HSP10    TZ53_15995 Mitochondrial biogenesis [BR:syb03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     TZ53_15995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  AJR25005 LinkDB All DBs Position 3453245..3453532 Genome browser AA seq 95 aa AA seqDB search MAFRPLHDRVLVRRVEAEEKTAGGIIIPDTAKEKPQEGEIVAVGTGSKSEDGKVTPLDVK AGDRILFGKWSGTEVKVDGEDLLIMKESDILGVVA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggcatttcgtccgttgcatgaccgcgttctcgttcgccgcgtagaggcggaagagaag actgccggcggcatcatcatccccgacaccgccaaggaaaagccgcaggaaggcgaaatc gtcgccgtcggcaccggcagcaagtcggaagacggcaaggtcactccgctggacgtcaag gccggcgaccgcatcctgttcggcaagtggtcgggcaccgaggtcaaggtcgacggtgaa gacctgctgatcatgaaggaatcggacattctcggcgtcgtcgcgtaa

DBGET integrated database retrieval system