Sphingobium sp. YBL2: TZ53_17920 Help Entry TZ53_17920        CDS       T03855                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism syb  Sphingobium sp. YBL2 Brite KEGG Orthology (KO) [BR:syb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:syb03032]     TZ53_17920    03036 Chromosome and associated proteins [BR:syb03036]     TZ53_17920    03400 DNA repair and recombination proteins [BR:syb03400]     TZ53_17920 DNA replication proteins [BR:syb03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     TZ53_17920 Chromosome and associated proteins [BR:syb03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     TZ53_17920 DNA repair and recombination proteins [BR:syb03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       TZ53_17920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 PqqD Motif Other DBs NCBI-ProteinID:  AJR25320 UniProt:  A0A0C5XLD7 LinkDB All DBs Position complement(3889897..3890172) Genome browser AA seq 91 aa AA seqDB search MNNSDLAEALAAEHDVTKADARKLVDAVFANIAGAAAKGEEISLNGFGKFKVKDQPAREG RNPSTGATIQIAASKKLAFTPAKAVKDQLNG NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaacaatagcgatctggctgaagcactggccgccgagcatgacgtcaccaaggccgat gcccgcaagctggtcgacgcggtcttcgcgaatatcgccggcgcagcagcgaagggcgaa gagatttcactgaacggtttcggcaagttcaaagtcaaggatcagcccgcccgcgaaggc cgcaatccctcgaccggcgcaacgatccagattgcggcgtcgaagaagcttgccttcacg cccgccaaggcggtcaaggatcagttgaacggctga

DBGET integrated database retrieval system