Synechococcus elongatus PCC7942: Synpcc7942_0536 Help Entry Synpcc7942_0536   CDS       T00300                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism syf  Synechococcus elongatus PCC7942 Pathway syf01100   Metabolic pathways syf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:syf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Synpcc7942_0536    00074 Mycolic acid biosynthesis     Synpcc7942_0536   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Synpcc7942_0536 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  ABB56568 UniProt:  Q31QV1 LinkDB All DBs Position 519792..520034 Genome browser AA seq 80 aa AA seqDB search MSQEDIFSKVKDIVAEQLSVDVAEVKPESSFQNDLGADSLDTVELVMALEEAFDIEIPDE AAEGIATVQDAVDFIASKAA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagccaagaagacatcttcagcaaagtcaaagacattgtggctgagcagctgagtgtg gatgtggctgaagtcaagccagaatccagcttccaaaacgatctgggagcggactcgctg gacaccgtggaactggtgatggctctggaagaggctttcgatatcgaaatccccgatgaa gccgctgaaggcattgcgaccgttcaagacgccgtcgatttcatcgctagcaaagctgcc tag

DBGET integrated database retrieval system