Shewanella yunxiaonensis: KDN34_16265 Help Entry KDN34_16265       CDS       T07775                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism syk  Shewanella yunxiaonensis Pathway syk01100   Metabolic pathways syk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:syk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KDN34_16265    00074 Mycolic acid biosynthesis     KDN34_16265   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KDN34_16265 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QUN05710 LinkDB All DBs Position 3561956..3562204 Genome browser AA seq 82 aa AA seqDB search MQNREQILQMLSRILEDEFEIDAADITPEASLYQDLDLDSIDAVDLVIKLQQITGKKIQP EAFKAVRTVDDVVNAIQQLVND NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcaaaaccgtgaacagatcctgcagatgctgagccgtattctggaagatgaattcgaa atagacgcggcagatatcaccccggaagcatcgctgtatcaagatctggatttagacagc attgacgccgtagatttagtgataaaactgcagcagatcaccggcaaaaaaattcagccc gaagcctttaaagcggttcggactgtcgatgatgtggtgaatgctattcagcagttggtc aatgattga

DBGET integrated database retrieval system