KEGG   Shewanella yunxiaonensis: KDN34_17100
Entry
KDN34_17100       CDS       T07775                                 
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
syk  Shewanella yunxiaonensis
Pathway
syk00770  Pantothenate and CoA biosynthesis
syk01100  Metabolic pathways
syk01240  Biosynthesis of cofactors
Module
syk_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:syk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    KDN34_17100 (coaD)
Enzymes [BR:syk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     KDN34_17100 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig ATP-sulfurylase
Other DBs
NCBI-ProteinID: QUN05862
UniProt: A0ABX7YT17
LinkDB
Position
complement(3741560..3742054)
AA seq 164 aa
MHTRAIYPGTFDPVTNGHTDLIERAAALFPSLVIAVAANPSKQPRFSLQQRVDMLQTVTA
HLPNVEVVGFSGLLVDFAKQQQASVLVRGLRAVSDFEYEFQLASMNRRLFPGLESVFLTP
SEENSFISSTLVKEVALHGGDISQFVHPEVAKALVQVFKKQGSN
NT seq 495 nt   +upstreamnt  +downstreamnt
atgcataccagagccatctatcccggaacgtttgatcccgtcaccaatggtcataccgat
ctgatcgagcgcgcggcagcgttgttcccgtcactcgtcattgcggttgctgctaatccc
tcgaaacagccacgattttcgctgcaacaacgcgttgatatgttgcaaaccgtgacggcg
catctgcccaacgttgaagtggtgggatttagtggattgctggtggattttgccaaacag
caacaggcgagcgtgttggtgcgcgggttacgggcagtgtctgactttgaatatgagttt
cagctggccagcatgaatcgacgccttttcccaggattggagagtgtgtttctaacacca
tccgaagaaaactcttttatctcatcgacattggtgaaagaggtggcgctacatggcggc
gatatcagccagtttgtccatcctgaagtcgcgaaagcactggtgcaagtatttaaaaaa
caaggaagtaattga

DBGET integrated database retrieval system