Synechococcus sp. KORDI-100: KR100_06280
Help
Entry
KR100_06280 CDS
T03344
Name
(GenBank) hypothetical protein
KO
K01297
muramoyltetrapeptide carboxypeptidase [EC:
3.4.17.13
]
Organism
synk
Synechococcus sp. KORDI-100
Brite
KEGG Orthology (KO) [BR:
synk00001
]
09180 Brite Hierarchies
09181 Protein families: metabolism
01002 Peptidases and inhibitors [BR:
synk01002
]
KR100_06280
01011 Peptidoglycan biosynthesis and degradation proteins [BR:
synk01011
]
KR100_06280
Enzymes [BR:
synk01000
]
3. Hydrolases
3.4 Acting on peptide bonds (peptidases)
3.4.17 Metallocarboxypeptidases
3.4.17.13 muramoyltetrapeptide carboxypeptidase
KR100_06280
Peptidases and inhibitors [BR:
synk01002
]
Serine peptidases
Family S66
KR100_06280
Peptidoglycan biosynthesis and degradation proteins [BR:
synk01011
]
Precursor biosynthesis
Carboxypeptidase
KR100_06280
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Peptidase_S66C
Peptidase_S66
Motif
Other DBs
NCBI-ProteinID:
AII42974
LinkDB
All DBs
Position
complement(1167516..1168487)
Genome browser
AA seq
323 aa
AA seq
DB search
MFGRRRLLISGMTAITASLLSRPGASITRFQGHRKAPPPLRRGSKLRAVNPGTWMDPETD
FSALQQRCEARGWQLEIPEAVRQQWRYFSGTDADRVRELEAAWNDPSIEGVLYVGGGWGG
ARVLEAGFRFPQRAIWTVGFSDSSSLLLAQWAAGLAGAIHGSSGGPDERWQRTAALLGGE
PVPALIGSPVRSGVGIGPLIVTNLTVATHLIGTPWLPKLTGAILVLEDVGEAPYRVDRML
THWRSAGLLRDLAGVACGRFSWKKDDILPGDFTMDEILEQRLGDLGIPLVMNLPLGHGRP
NMALPIGQEARLDGGRGELNLLN
NT seq
972 nt
NT seq
+upstream
nt +downstream
nt
atgttcggccgccgccggctcctgatctcggggatgaccgcaatcacggcgtccctgctg
tcccgtcccggggccagcatcacccggttccagggtcatcgaaaagcaccgccgccactg
cgacggggatcaaaacttcgggcggtgaatccaggcacatggatggatcctgagacggac
ttctccgccctgcagcagcgctgtgaagcacgtggctggcagctggagattccagaggcc
gtccgccagcagtggcgctatttctccggaaccgatgcagaccgcgttcgggagctggag
gcggcctggaatgatccctcgattgagggggtgctctacgtcggcggaggctggggtggg
gcccgggttctggaggcgggtttccgctttcctcaacgcgccatctggactgtgggattc
tccgactccagttccctgctgctggcccagtgggccgcggggttggcaggcgcgatccac
ggatccagtggtggaccggacgaacgttggcagcgcactgcagcgttgctcggcggagaa
ccggttccggcgctgatcgggagcccggtgcgctcaggagtgggcatcggaccgctcatc
gtgaccaatctcaccgtggcgacccatctgatcggaacgccttggttacccaagctcaca
ggggccattctggttctggaggatgtaggcgaagctccctatcgcgttgaccgcatgctc
acgcactggcgcagcgccggtctgctgcgcgatctggcgggagtggcctgtggacgcttc
agctggaaaaaagacgacatcctgcccggagatttcacgatggatgaaatccttgaacag
cggctcggggaccttggcatacccctggtgatgaatctccccctcggtcatggacgcccc
aacatggccttgccgattgggcaggaagcacgtcttgatggggggcggggagaactgaac
ctgctgaactga
DBGET
integrated database retrieval system