Synechococcus sp. KORDI-100: KR100_07400
Help
Entry
KR100_07400 CDS
T03344
Name
(GenBank) hypothetical protein
Organism
synk
Synechococcus sp. KORDI-100
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
LytR_cpsA_psr
Motif
Other DBs
NCBI-ProteinID:
AII43187
LinkDB
All DBs
Position
1339018..1339977
Genome browser
AA seq
319 aa
AA seq
DB search
MATPSSPAQPPRDRAVWIAAVVGLAGGLMLSVPLTRSLQGDQTPAAPQTRSLQGDQTPAA
PQTLSNPFGSWAGFGVQDVVVLGRDASGSNTDTIFTLRVEGGRTVITQIPRDSYVNADGF
GAMKINGLLAAGGPEAVERELTRLMDRPIRHHIVVKLDAISTLADLVGGIEVDVPKRLYY
VDRSQGLVIDLQPGKQLLKGKELEGFLRWRNDGRGDFGRLERQQLALKALFERIKQPQNL
IRLPALIAAAGNELQTDLGPVELGGLVTAIGSTDLDTKRLKATPFSRGGVSYLDTEWPAK
DSSGVEASEASSRRSQFLF
NT seq
960 nt
NT seq
+upstream
nt +downstream
nt
atggccacgccgtcctcccctgctcagcctccccgggatcgggcggtatggatcgctgcg
gttgtaggacttgccggtggcctgatgctttcggtgccgctgacccgcagcctgcagggc
gatcagaccccggcagcaccgcagacccgcagcctgcagggcgatcagaccccggcagca
ccgcagacgttgagcaatccgtttggaagctgggctggcttcggggttcaggacgtggtc
gtgctcggccgtgatgcctccggcagcaacaccgacacgatcttcacgctgcgggtggag
ggtggtcgcaccgtgatcacccagatccctagggacagttacgtgaatgccgacggcttc
ggggcgatgaagatcaatggcctgctggccgctggtggaccggaggcggtggagcgggaa
ctcacgcggctgatggatcgaccgatccgccaccacatcgtggtgaaactggatgcgatc
agcaccctggctgatctggtgggtggcatcgaggtggatgtgcccaagcggctgtattac
gtcgaccgcagccagggattggtgatcgatctgcagccgggcaagcaacttctgaaaggc
aaggagctggagggcttcctgcgctggcgcaacgacggccgcggcgatttcggccggctg
gaacgccagcaactggcgttgaaggcgttgtttgaacggatcaagcagccgcagaatctg
atccggctaccggccttgattgcagcggccggcaacgaactgcagaccgatcttgggccg
gttgagctgggcggattggtcacagcgatcggtagcactgatctggacacgaagcggttg
aaggcaaccccgttcagccgtggcggtgtgagctatctcgatacggaatggccagcgaaa
gacagcagcggcgtggaagccagtgaagcgagcagccgccgctcgcaatttttgttttga
DBGET
integrated database retrieval system