KEGG   Synechococcus sp. NIES-970: NIES970_21750
Entry
NIES970_21750     CDS       T09762                                 
Symbol
moaE
Name
(GenBank) molybdopterin converting factor, chain 2
  KO
K03635  molybdopterin synthase catalytic subunit [EC:2.8.1.12]
Organism
synn  Synechococcus sp. NIES-970
Pathway
synn00790  Folate biosynthesis
synn01100  Metabolic pathways
synn01240  Biosynthesis of cofactors
synn04122  Sulfur relay system
Module
synn_M00880  Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:synn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NIES970_21750 (moaE)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    NIES970_21750 (moaE)
Enzymes [BR:synn01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.12  molybdopterin synthase
     NIES970_21750 (moaE)
SSDB
Motif
Pfam: MoaE tRNA_anti-codon
Other DBs
NCBI-ProteinID: BAW97226
UniProt: A0A1Q2TZS8
LinkDB
Position
2262969..2263427
AA seq 152 aa
MRVPTYSHDQFAITFAPLSFEEVYRLAEDPGSGAVVVMSGTVRNRSDGKAVHYLEYQAYE
PMAIAVFQQIAHDIRQQWPDTNRVIIHHRVGKLEIGEISVLIAASCPHRAEAFAACRYGI
DTIKHNAPIWKKEFFAGGTSEWVQGCRTATGC
NT seq 459 nt   +upstreamnt  +downstreamnt
atgcgcgttcctacctattcccacgaccaatttgccattacctttgcgcccttatctttt
gaggaagtgtatcgtctcgctgaagaccctggcagcggggcagtggtggtgatgagtggc
acagtccgtaaccgcagtgatggcaaagcggttcattatctcgaataccaagcttacgaa
ccgatggcgatcgccgtttttcagcaaattgcccatgacatccgccaacagtggcccgac
accaaccgcgtgatcattcaccaccgcgtcggcaaactggaaatcggtgaaatcagtgtt
ctcattgccgccagttgtccccaccgggctgaagcctttgccgcttgccgctatggcatc
gatactattaagcacaatgcccccatctggaagaaggaattttttgccgggggcaccagc
gaatgggtccagggttgccgcactgctacgggctgttaa

DBGET integrated database retrieval system