Synechococcus sp. KORDI-49: KR49_10295 Help Entry KR49_10295        CDS       T03345                                  Name (GenBank) primosome subunit DnaD   KO K03116   sec-independent protein translocase protein TatA Organism synr  Synechococcus sp. KORDI-49 Pathway synr03060   Protein export synr03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:synr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     KR49_10295  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     KR49_10295  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:synr02044]     KR49_10295 Secretion system [BR:synr02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    KR49_10295 SSDB OrthologParalogGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  AII46826 LinkDB All DBs Position 1889387..1889620 Genome browser AA seq 77 aa AA seqDB search MNVFGVGLPEMAVIGAVALLVFGPKRLPELGKTLGKTLKGFQSASKEFEREINKAMADPE LEDGSGDSPQDNDSPQV NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgaatgtcttcggcgtcggcctccctgagatggcggtgatcggcgccgttgccttgctt gtcttcggtcccaagcgtcttccggaactcggcaagacgctggggaaaacgctcaaagga tttcagtccgcctccaaggagttcgagcgggagatcaacaaggccatggccgatcccgag ctcgaggatggctccggagactcgccccaggacaacgattcaccccaggtctga

DBGET integrated database retrieval system