KEGG   Synechocystis sp. LKSZ1: OLK001_03770
Entry
OLK001_03770      CDS       T10519                                 
Symbol
serA
Name
(GenBank) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
syns  Synechocystis sp. LKSZ1
Pathway
syns00260  Glycine, serine and threonine metabolism
syns00270  Cysteine and methionine metabolism
syns00680  Methane metabolism
syns01100  Metabolic pathways
syns01110  Biosynthesis of secondary metabolites
syns01120  Microbial metabolism in diverse environments
syns01200  Carbon metabolism
syns01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:syns00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    OLK001_03770 (serA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OLK001_03770 (serA)
   00270 Cysteine and methionine metabolism
    OLK001_03770 (serA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:syns04147]
    OLK001_03770 (serA)
Enzymes [BR:syns01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     OLK001_03770 (serA)
    1.1.1.399  2-oxoglutarate reductase
     OLK001_03770 (serA)
Exosome [BR:syns04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OLK001_03770 (serA)
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh PGDH_inter ACT NAD_binding_2 ACT_AHAS_ss
Other DBs
NCBI-ProteinID: BFM38451
LinkDB
Position
complement(402946..404523)
AA seq 525 aa
MAKILVSDPIDQVGINILQQVAQVDIKTGLPEAEIIKIIPEYDAMMLRSGTKVTRPIIEA
GTQLKIIGRAGVGVDNIDVPAATRQGIVVVNSPEGNTIAAAEHALAMMMALARHIPDANQ
SVKAGQWDRKRFIGTEVYKKTLGVVGLGKIGSHVATVAKSMGMKLLAYDPFISKERADQL
GCTLVDLDLLFSESDFITLHIPKTPETTNLINAETLAKMKPTARLINCSRGGIIDEAALA
AAIEAGQIAGAALDVFNEEPLGESRLREFSNVILTPHLGASTAEAQVNVSIDVAEQIRDV
LLGLPARSAVNIPGLTPDVMEKLRPYLQLAETLGTLVGQLAGGRIEQLTVRLQGDLAENV
GQPIVVASIKGLLSQALRERVNYVNAALEAKERGIRVIETRDAAIRDYSGSLHLQATGSM
GEHSATGVLLSNGEIRITDVDGFPLNVPPSNYMLFTLHRDMPGIIGKIGSLLGSFNVNIA
SMQVGRKIVRGDAVMALSLDDPLPEGLLAEIIKVPGIRDAYIVKL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggccaaaattctggtctctgaccccatcgatcaagttggtattaatattcttcagcaa
gtcgcccaagtcgatatcaaaacgggcctgccggaagcggagattatcaaaatcattcct
gagtacgatgccatgatgttgcggtcggggacaaaggtcactcggcccatcattgaagcg
ggcacgcaactcaagattattggccgggccggtgtcggggtagataatattgatgtccca
gcggccacccgtcagggcattgttgtggttaattcgcccgaaggcaataccattgcggcg
gcagaacatgccctggccatgatgatggccctcgcacgccacattcctgatgccaatcag
tccgtaaaagcgggccaatgggaccggaagcgttttatcggcacagaagtctacaaaaaa
accctaggcgttgtgggtctcggcaagattggttctcatgtggctaccgttgccaagtcc
atgggcatgaaactcttggcctacgacccctttatctctaaggagcgggctgaccaattg
ggctgtaccctggttgacttagatttactattttctgagtctgactttattacgcttcat
atccccaaaaccccggagaccactaacctgatcaacgccgaaaccctggccaaaatgaaa
ccgacggctcggctaattaactgttctcggggaggcattattgacgaagcggccctggcc
gctgccattgaagcgggccaaattgccggagcggccctggatgttttcaacgaagaaccc
ttgggagaatcccgtctgcgcgagtttagcaacgtgatcctaaccccccacctcggcgca
tccaccgctgaagcccaggtgaatgtttccatcgatgtagcagaacaaattcgggatgtg
ctattgggcctgccggcgcgttctgcggtcaatatccccggtctcacccccgatgtgatg
gagaagctacgcccctacctccagcttgccgaaaccctgggtaccttggtcggccaatta
gccgggggccggatcgagcaactcaccgtacgtctacagggcgatctggccgaaaacgtg
ggtcagccgatcgtggtggcctccatcaaaggcctcctctcccaggccctgcgcgaacgc
gttaattacgtcaatgcggccctagaggccaaggaacggggcatccgtgtgattgaaact
cgtgatgcggccatccgtgactattccggctccctgcatctccaggccacgggatcgatg
ggagaacattctgcgacgggcgttctgctcagcaatggcgaaattcggattacggatgtc
gatggcttccccctcaacgtcccccccagcaactacatgctctttactctgcaccgcgat
atgccgggtattattggcaaaattggctccctcctgggcagtttcaatgtcaacatcgcc
agtatgcaggtgggacgcaaaattgtgcggggagatgcggtcatggccctcagcttagat
gaccccctgccagagggcctcttggcagaaattatcaaagtgccggggattcgcgatgcc
tacattgtgaaactttga

DBGET integrated database retrieval system