Streptomyces yunnanensis: MOV08_41690 Help Entry MOV08_41690       CDS       T09344                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism syun  Streptomyces yunnanensis Pathway syun00998   Biosynthesis of various antibiotics syun01100   Metabolic pathways syun01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:syun00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MOV08_41690    00074 Mycolic acid biosynthesis     MOV08_41690   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MOV08_41690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WEB46096 LinkDB All DBs Position complement(9457696..9457953) Genome browser AA seq 85 aa AA seqDB search MLHAVLGEYGGVVDAGITMDTRFHDDLDLESIDLVTLGGHLQARYGELVNFAEYLAGLGL EEIIDLTVGQLVEHITGCLRAAEER NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgctccacgccgtcctcggcgagtacgggggcgtggtggacgccgggatcaccatggac acccggttccacgacgacctggacctggagagcatcgacctggtcaccctcggcggccac ctccaggcgcgctacggggagctggtgaacttcgccgagtacctggccgggctcgggctg gaggagatcatcgacctgacggtcggacagctcgtcgagcacatcaccggctgcctgcgg gccgccgaggagcggtga

DBGET integrated database retrieval system