Shewanella zhangzhouensis: K0H63_16575 Help Entry K0H63_16575       CDS       T09194                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism szh  Shewanella zhangzhouensis Pathway szh02024   Quorum sensing szh03018   RNA degradation Brite KEGG Orthology (KO) [BR:szh00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     K0H63_16575 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     K0H63_16575 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:szh03019]     K0H63_16575 (hfq)    03036 Chromosome and associated proteins [BR:szh03036]     K0H63_16575 (hfq) Messenger RNA biogenesis [BR:szh03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      K0H63_16575 (hfq) Chromosome and associated proteins [BR:szh03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     K0H63_16575 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 DUF7327 Motif Other DBs NCBI-ProteinID:  QYK04655 LinkDB All DBs Position complement(3774513..3774785) Genome browser AA seq 90 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAIS TVVPSRPFNVGSHQGGSNYNAQQDDSAGEQ NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttacaagacccatttttgaacgcactgcgccgtgagcgtgtt cccgtttctatttatttggttaacggcatcaagcttcagggacaggttgagtctttcgac cagttcgtgatcctgctgaaaaacactgtaagccagatggtttacaagcacgccatttct accgttgttccatcccgtccattcaacgtgggcagtcatcagggtggcagcaactacaat gcccaacaagacgacagtgccggcgagcagtaa

DBGET integrated database retrieval system