Shinella zoogloeoides: K8M09_00325
Help
Entry
K8M09_00325 CDS
T07727
Symbol
yidC
Name
(GenBank) membrane protein insertase YidC
KO
K03217
YidC/Oxa1 family membrane protein insertase
Organism
szo
Shinella zoogloeoides
Pathway
szo02024
Quorum sensing
szo03060
Protein export
szo03070
Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:
szo00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03060 Protein export
K8M09_00325 (yidC)
09130 Environmental Information Processing
09131 Membrane transport
03070 Bacterial secretion system
K8M09_00325 (yidC)
09140 Cellular Processes
09145 Cellular community - prokaryotes
02024 Quorum sensing
K8M09_00325 (yidC)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03029 Mitochondrial biogenesis [BR:
szo03029
]
K8M09_00325 (yidC)
09183 Protein families: signaling and cellular processes
02044 Secretion system [BR:
szo02044
]
K8M09_00325 (yidC)
Mitochondrial biogenesis [BR:
szo03029
]
Mitochondrial quality control factors
Mitochondrial respiratory chain complex assembly factors
Complex-IV assembly factors
K8M09_00325 (yidC)
Secretion system [BR:
szo02044
]
Sec (secretion) system
Prokaryotic Sec-SRP core components
K8M09_00325 (yidC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
YidC_periplas
60KD_IMP
OAD_gamma
Motif
Other DBs
NCBI-ProteinID:
UEX81801
LinkDB
All DBs
Position
complement(63518..65320)
Genome browser
AA seq
600 aa
AA seq
DB search
MEKNRNYFVAIALSVLILVAWQFLYVNPKLEKERAALEAQQAAQTQQTTASGGTAATTPA
AGTSGALPGGAATATATETREDALARSARVQIDTPSLSGSINLTGARFDDLRLKQFHETV
DDTSPIITLLSPAETEHGYFAEFGYVGSEATGAVPGPQTLWAQQGDGKLTQTTPVTLTYT
NERGVTFLRTISVDEHYMFSITDSIQNTTDAAIAISPYGRTARFFKPTTPSVYVLHEGFI
GVLGDLGLHEVKYKETEDDTTVAPGKATGGWLGITDKYWATALVPPQASPFETRFSHFTD
GRPRYQADYRQEDITIAPGQTIEVKNLFFGGAKEVPIIDQYKKTYAIPQFDLMIDWGWFW
FFTKPMFQLMDFIYRYFGNFGIAILFTTIIVKGLFFPLANKQYASMANMKKMQPKMEELK
AKHGDDRMALQQAMMQLYKEEKINPLAGCWPILLQIPVFFALYKVIYVTIEMRHAPFFGW
IQDLSAPDPTSIFNLFGLLPFEVPHMLMIGVWPLIMGVTMFLQMRMNPTPPDPTQAMIFT
WMPLVFTFMLATFPAGLVIYWAWNNTLSIIQQAIIMKRHGVKIELFDNLKGLFSKKPKPS
NT seq
1803 nt
NT seq
+upstream
nt +downstream
nt
atggaaaaaaaccgcaattatttcgtggcgatcgcgctgtccgtgctgatcctcgtcgcg
tggcagttcctctatgtgaaccccaagctcgagaaggagcgcgccgcgctcgaggcccag
caggccgcccagacgcagcagacgaccgctagcggcggcacggccgccacgaccccggcg
gccggcaccagcggcgcgctgccgggtggcgcagcgacggcgacggcgaccgagacgcgt
gaagacgcgctcgcccgctccgcccgcgtccagatcgacacgccctcgctctccggctcc
atcaacctgacgggcgcccgtttcgacgacctcaggctcaagcagttccacgagaccgtc
gacgacaccagcccgatcatcacgcttctcagcccggccgagaccgaacacggctacttc
gccgaattcggctatgtcggcagcgaggcgaccggcgccgtacccggcccgcagaccctc
tgggcgcagcagggcgacggcaagctgacgcagacgaccccggtgacgctgacctacacc
aacgagcggggcgtcaccttcctgcgcaccatctcggtcgacgaacattacatgttctcc
atcaccgacagcatccagaacaccacggatgcggcgatcgccatttcaccctacggccgc
acggcgcgcttcttcaagccgacgaccccgtccgtctacgtgctgcacgaaggcttcatc
ggcgtgctcggcgacctcggcctgcatgaggtgaagtacaaggaaaccgaggacgacacg
accgtcgcgcccggcaaggcgaccggcggctggctcggcatcaccgacaaatactgggcg
accgccctggtgccgccgcaggcaagccccttcgagacgcgcttctcccacttcaccgac
ggccgtccgcgctaccaggcggactaccgccaggaagacatcaccatcgcgcccggccag
acgatcgaggtcaagaacctgttcttcggcggcgccaaggaagtgccgatcatcgaccag
tacaagaagacctatgccattccgcagttcgacctgatgatcgactggggctggttctgg
ttcttcaccaagccgatgttccagttgatggacttcatctaccgctacttcggcaatttc
ggcatcgcgatcctcttcacgacgatcatcgtcaagggcctcttcttcccgctggccaac
aagcagtacgcctccatggcgaacatgaagaagatgcagccgaagatggaagagctgaag
gccaagcacggcgacgaccgcatggcgctgcaacaggccatgatgcagctctacaaggag
gagaagatcaatccgctggcgggttgctggccgatcctcctgcagatcccggtcttcttc
gcactctacaaggtgatctacgtcacgatcgaaatgcgccatgcgccgttcttcggctgg
atccaggacctttcggcgcccgatccgacctcgatcttcaacctgttcggcctgctgccc
ttcgaagtgccgcatatgctgatgatcggcgtctggccgctgatcatgggcgtcaccatg
ttcctgcagatgcgcatgaacccgacgccgcccgacccgacccaggcgatgatcttcacc
tggatgccgctggtcttcaccttcatgctggcgaccttcccggccggcctcgtgatctac
tgggcctggaacaacacgctctcgatcatccagcaggcgatcatcatgaagcgccatggt
gtgaagatcgagctgttcgacaacctgaagggcctgttcagcaagaagccgaaaccatcc
tga
DBGET
integrated database retrieval system