Shinella zoogloeoides: K8M09_00885 Help Entry K8M09_00885       CDS       T07727                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism szo  Shinella zoogloeoides Pathway szo01100   Metabolic pathways szo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:szo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K8M09_00885    00074 Mycolic acid biosynthesis     K8M09_00885   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K8M09_00885 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  UEX83770 LinkDB All DBs Position complement(186768..187016) Genome browser AA seq 82 aa AA seqDB search MEDGRADIAERVKDIIIGQLAVEKSKVVDDASIVDDLGADSLEVVQIVMLIEDEFGIAIP DEPAEEFLTVRDAIDFVVASQS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggaagacggaagagccgatattgccgagcgtgtgaaagacatcatcatcggacagttg gccgtcgagaaatcgaaggtcgtcgatgacgcttcaattgtcgatgacctgggcgctgat tccttggaggtggtccaaatcgtgatgctcattgaagacgagtttggcatcgccattcct gacgagccggccgaggaattcctgacggttcgggacgccatcgacttcgtggtcgcatca cagtcgtga

DBGET integrated database retrieval system