Shinella zoogloeoides: K8M09_05315 Help Entry K8M09_05315       CDS       T07727                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism szo  Shinella zoogloeoides Pathway szo01100   Metabolic pathways szo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:szo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K8M09_05315    00074 Mycolic acid biosynthesis     K8M09_05315   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K8M09_05315 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Delta_lysin Motif Other DBs NCBI-ProteinID:  UEX82698 LinkDB All DBs Position 1072381..1072617 Genome browser AA seq 78 aa AA seqDB search MSDVAERVKKIVIDHLGVDAEKVSEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgtagcagaacgcgtaaagaaaattgtcattgatcatctgggcgttgacgcc gaaaaggtcagcgaaggcgcaagcttcatcgatgaccttggcgcggactcgctcgacacc gtcgaactggtcatggcgttcgaagaagaattcggcgtcgagatcccggacgatgccgct gactcgatcctgacggtcggcgacgccgtcaagttcatcgagaaggcccaggcctga

DBGET integrated database retrieval system