Tumebacillus algifaecis: CIG75_05655 Help Entry CIG75_05655       CDS       T04994                                  Name (GenBank) hypothetical protein   KO K06371   developmental checkpoint coupling sporulation initiation to replication initiation Organism tab  Tumebacillus algifaecis Brite KEGG Orthology (KO) [BR:tab00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99978 Cell growth     CIG75_05655 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sda Motif Other DBs NCBI-ProteinID:  ASS74532 UniProt:  A0A223CYV9 LinkDB All DBs Position complement(1251755..1251895) Genome browser AA seq 46 aa AA seqDB search MHLLSDEYLVEAYTNAVKQKLDRQFIDLLYREVQARGLTVSVGIAS NT seq 141 nt NT seq  +upstreamnt  +downstreamnt atgcatttgctgagtgatgagtaccttgttgaagcttacacgaatgcagtgaaacagaag ttggaccgacagtttatcgaccttttgtacagggaagtccaagcacggggtcttacagtc tctgtcggcatcgcttcgtaa

DBGET integrated database retrieval system