Tumebacillus algifaecis: CIG75_12355 Help Entry CIG75_12355       CDS       T04994                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tab  Tumebacillus algifaecis Pathway tab00998   Biosynthesis of various antibiotics tab01100   Metabolic pathways tab01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tab00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CIG75_12355 (acpP)    00074 Mycolic acid biosynthesis     CIG75_12355 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CIG75_12355 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Guanylate_cyc TMEM210 Motif Other DBs NCBI-ProteinID:  ASS75696 UniProt:  A0A223D2T5 LinkDB All DBs Position complement(2941778..2942014) Genome browser AA seq 78 aa AA seqDB search MSEEIYAKVKTIIVDRLGVEEDQVKLEASFKEDLGADSLDVVELVMELEDEFDMEISDED AEKINTVGDVVSYISSNK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtctgaagaaatctatgcaaaagtaaaaaccatcatcgtagaccgactgggtgtcgag gaagatcaagttaaacttgaagcctctttcaaagaagaccttggtgccgactctcttgat gttgttgagttggtgatggaactcgaagatgagttcgatatggaaatctctgatgaagac gcagagaagatcaacaccgtaggtgacgtagtcagctacatctcttcgaataagtaa

DBGET integrated database retrieval system